PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 82aa    MW: 9563.23 Da    PI: 4.042
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11198.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97e-113776344
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                      ++++E+ l+++ +++ G + W++Ia +++ gRt++++  +w
        PK11198.1 37 EFSEDEESLIIRMFNLIGER-WSLIAGRIP-GRTAEEIEKYW 76
                     69******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.0373082IPR017930Myb domain
SMARTSM007172.0E-73482IPR001005SANT/Myb domain
CDDcd001671.20E-73776No hitNo description
PfamPF002495.2E-103777IPR001005SANT/Myb domain
SuperFamilySSF466894.99E-93779IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-133778IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MADSEHSSCD DNFAHSQAEE EEVMSEESIR REVVEVEFSE DEESLIIRMF NLIGERWSLI  60
AGRIPGRTAE EIEKYWVSKY SX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317211.15e-30hypothetical protein POPTR_0011s00390g
SwissprotQ9LNI51e-17ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLB9HZL85e-30B9HZL8_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00390.11e-29(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.12e-16MYB_related family protein